Structure of PDB 8btd Chain Lk

Receptor sequence

>8btdLk (length=88) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

SKGTASFGKRHTRIHGSCRRCGKHSFHLQKHECASCGYPSAKMRRYNWSY
KSLRRRTQGTGSMSHMRKVYRAYNSGTLKANARKYLAK

3D structure

PDB

8btd Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

4.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lk	R20 R21 C22 G23 Y39 S41 M44 R57 Q59 G60 M64 H66 M67 V70 Y71 Y74 S76	R19 R20 C21 G22 Y38 S40 M43 R56 Q58 G59 M63 H65 M66 V69 Y70 Y73 S75
BS02	rna	Lk	S2 K3 G4 T5 A6 S7 F8 G9 K10 R11 H12 T13 R14 I15 H16 H28 K31 A35 K43 M44 R45 R46 Y47 N48 W49 S50 K52 R55 R56 Q59	S1 K2 G3 T4 A5 S6 F7 G8 K9 R10 H11 T12 R13 I14 H15 H27 K30 A34 K42 M43 R44 R45 Y46 N47 W48 S49 K51 R54 R55 Q58

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links