Structure of PDB 8y0u Chain Lj

Receptor sequence

>8y0uLj (length=85) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKA

3D structure

PDB

8y0u dormant ribosome with STM1

Chain

Resolution

3.59 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Lj	G2 K3 G4 T5 P6 F8 G9 K10 R11 H12 N13 S15 H16 R24 R25 H28 Q30 K31 S35 K43 T44 R45 Y47 N48 W49 K52 K54 R55 R56	G1 K2 G3 T4 P5 F7 G8 K9 R10 H11 N12 S14 H15 R23 R24 H27 Q29 K30 S34 K42 T43 R44 Y46 N47 W48 K51 K53 R54 R55
BS02	rna	Lj	R21 C22 T59 T61 G62 R63 M64 R65 Y66 L67 R72 F74 N76 Q79 T80 G81 S82 A83 K85	R20 C21 T58 T60 G61 R62 M63 R64 Y65 L66 R71 F73 N75 Q78 T79 G80 S81 A82 K84
BS03	ZN	Lj	C19 C22 C34 C37	C18 C21 C33 C36

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum	8y0u
PubMed	38698775
UniProt	P49166\|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)