Structure of PDB 8xt2 Chain Lj

Receptor sequence
>8xt2Lj (length=38) Species: 9606 (Homo sapiens) [Search protein sequence]
FKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
3D structure
PDB8xt2 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLj
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lj F66 N68 K69 T70 V71 L72 K73 K74 R75 L81 K83 R84 R85 G86 W88 Y89 Y91 P96 R97 K99 R101 F1 N3 K4 T5 V6 L7 K8 K9 R10 L16 K18 R19 R20 G21 W23 Y24 Y26 P31 R32 K34 R36
BS02 ZN Lj C76 C92 H98 C11 C27 H33
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0016604 nuclear body
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xt2, PDBe:8xt2, PDBj:8xt2
PDBsum8xt2
PubMed38942792
UniProtQ9P0J6|RM36_HUMAN Large ribosomal subunit protein bL36m (Gene Name=MRPL36)

[Back to BioLiP]