Structure of PDB 8k82 Chain Lj

Receptor sequence

>8k82Lj (length=82) Species: 4932 (Saccharomyces cerevisiae)

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSA

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Lj
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lj	G2 K3 G4 T5 P6 S7 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 S26 H28 Q30 S35 K43 T44 R45 Y47 N48 W49 K52 R55 R56	G1 K2 G3 T4 P5 S6 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 S25 H27 Q29 S34 K42 T43 R44 Y46 N47 W48 K51 R54 R55
BS02	rna	Lj	R21 C22 G23 Y39 A42 T59 G60 T61 G62 R63 M64 R65 Y66 L67 K68 R72 F74 K75 N76 Q79 T80 G81 S82	R20 C21 G22 Y38 A41 T58 G59 T60 G61 R62 M63 R64 Y65 L66 K67 R71 F73 K74 N75 Q78 T79 G80 S81
BS03	T1C	Lj	K68 R72 K75	K67 R71 K74
BS04	ZN	Lj	C19 C22 C34 C37	C18 C21 C33 C36

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)