Structure of PDB 8i9w Chain Lj

Receptor sequence

>8i9wLj (length=74) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

KTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSEKAKRRKVTGTGR
MRYLSTVPRRFKNGFRTGVPKGAR

3D structure

PDB

8i9w Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Lj	T15 H16 R24 S26 H28 K31 A35 K43 T44 R45 K46 Y47 N48 W49 K52 R55 R56	T2 H3 R11 S13 H15 K18 A22 K30 T31 R32 K33 Y34 N35 W36 K39 R42 R43
BS02	rna	Lj	R20 R21 C22 L27 A42 T59 G62 R63 M64 Y66 L67 R72 F74 K75 N76 R79 G81 P83 R87	R7 R8 C9 L14 A29 T46 G49 R50 M51 Y53 L54 R59 F61 K62 N63 R66 G68 P70 R74
BS03	ZN	Lj	C19 C22 C34 C37	C6 C9 C21 C24

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links