Structure of PDB 7z3n Chain Lj

Receptor sequence

>7z3nLj (length=86) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

KGTSSFGKRHNKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSEK
AKRRKVTGTGRMRYLSTVPRRFKNGFRTGVPKGARG

3D structure

PDB

7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Lj	K3 T5 G9 K10 R11 H12 N13 T15 H16 R24 R25 H28 Q30 K31 A35 K43 T44 R45 K46 Y47 N48 W49 K52 R55 R56	K1 T3 G7 K8 R9 H10 N11 T13 H14 R22 R23 H26 Q28 K29 A33 K41 T42 R43 K44 Y45 N46 W47 K50 R53 R54
BS02	rna	Lj	R21 N29 K32 G62 R63 M64 Y66 R72 F74 N76 R79 G81 P83	R19 N27 K30 G60 R61 M62 Y64 R70 F72 N74 R77 G79 P81
BS03	ZN	Lj	C19 C22 C34 C37	C17 C20 C32 C35

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links