Structure of PDB 7old Chain Lj

Receptor sequence

>7oldLj (length=88) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

TKGTSSFGKRHNKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSE
KAKRRKVTGTGRMRYLSTVPRRFKNGFRTGVPKGARGP

3D structure

PDB

7old High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Lj	T2 K3 T5 F8 G9 R11 H12 N13 T15 H16 R24 R25 H28 Q30 A35 K43 T44 R45 K46 N48 W49 K52 R55 R56	T1 K2 T4 F7 G8 R10 H11 N12 T14 H15 R23 R24 H27 Q29 A34 K42 T43 R44 K45 N47 W48 K51 R54 R55
BS02	rna	Lj	R20 R21 N29 G62 R63 M64 Y66 L67 R72 F74 K75 N76 R79 T80 G81	R19 R20 N28 G61 R62 M63 Y65 L66 R71 F73 K74 N75 R78 T79 G80
BS03	ZN	Lj	C19 C34 C37	C18 C33 C36

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links