Structure of PDB 8xt3 Chain Li

Receptor sequence

>8xt3Li (length=95) Species: 9606 (Homo sapiens)

LTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKR
LREFVFCNKTQSKLLDKMTTSFWKRRNWYVDDPYQKYHDRTNLKV

3D structure

• PDB: 8xt3 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Li
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Li	L94 T95 F97 S98 A99 R100 K101 K103 R104 K105 T106 K108 R113 H118 R124 K126 A127 G128 K131 K132 L133 W134 K135 R140 K142 R143 N151 K152 T153 Q154 K156 F165 W166 R168 R169 W171 D182	L1 T2 F4 S5 A6 R7 K8 K10 R11 K12 T13 K15 R20 H25 R31 K33 A34 G35 K38 K39 L40 W41 K42 R47 K49 R50 N58 K59 T60 Q61 K63 F72 W73 R75 R76 W78 D89

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xt3, PDBe:8xt3, PDBj:8xt3
• PDBsum: 8xt3
• PubMed: 38942792
• UniProt: Q9NZE8|RM35_HUMAN Large ribosomal subunit protein bL35m (Gene Name=MRPL35)