Structure of PDB 8rxx Chain Li

Receptor sequence
>8rxxLi (length=102) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]
MSAPTPRTGIIAGFNKGHVTTRRPRQPSPNDRFAVPHKHLRAVKAIIADL
VGLSPLEKRVQEFLRVGKEKRALKYCKKRLGDFTAAKKKRSKMEEALRHA
TK
3D structure
PDB8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
ChainLi
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Li G17 H18 T20 R25 S28 P29 N30 R32 F33 P36 H37 K38 H39 L40 R41 K44 R79 L80 G81 D82 K87 K88 K92 G17 H18 T20 R25 S28 P29 N30 R32 F33 P36 H37 K38 H39 L40 R41 K44 R79 L80 G81 D82 K87 K88 K92
BS02 rna Li E62 V66 K68 K70 R71 F83 E62 V66 K68 K70 R71 F83
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum8rxx
PubMed38722744
UniProtQ4QCE1

[Back to BioLiP]