Structure of PDB 7zjw Chain Li

Receptor sequence

>7zjwLi (length=110) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYV
YKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHR
IRVMLYPSRI

3D structure

PDB

7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Li	M1 S2 G3 R4 W6 K8 K15 R16 L18 R19 N20 Q21 R22 E23 H24 K29 Y34 R36 Y51 K52 A53 K54 N55 N56 T57 V58 P60 T67 R68 V69 W71 K73 R76 H78 G79 N80 S81 R85 K87 R89 S90 N91 P93 A94 R100 R102	M1 S2 G3 R4 W6 K8 K15 R16 L18 R19 N20 Q21 R22 E23 H24 K29 Y34 R36 Y51 K52 A53 K54 N55 N56 T57 V58 P60 T67 R68 V69 W71 K73 R76 H78 G79 N80 S81 R85 K87 R89 S90 N91 P93 A94 R100 R102

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
PDBsum	7zjw
PubMed	35709277
UniProt	G1SF08\|RL35A_RABIT Large ribosomal subunit protein eL33 (Gene Name=RPL35A)