Structure of PDB 8rxh Chain Lh

Receptor sequence

>8rxhLh (length=127) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

SCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIHTPWVLGH
KRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQ
RIVKQALKEHSKMKLSHKRTANKKKSK

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Lh	C3 R5 Q7 R9 R10 R11 H13 Y14 T16 R17 T26 P27 G28 K30 Q34 R61 H62 R66	C2 R4 Q6 R8 R9 R10 H12 Y13 T15 R16 T25 P26 G27 K29 Q33 R60 H61 R65
BS02	rna	Lh	S2 C3 R5 V6 Y8 R11 Y14 R91 R94 V98 R102 K105 M114 H118 R120 K124	S1 C2 R4 V5 Y7 R10 Y13 R90 R93 V97 R101 K104 M113 H117 R119 K123
BS03	rna	Lh	S2 C3 R17 R20 M23 V24 R25 T26 P27 N29 L31 Q34 R36 K38 R39 S40 Q41 G42 H44 P46 W47 H51 R53 G55 G56 T57 K58 A59 R66 R70 H71 K73 S74 S76 R77 Y79 G80 G81 V82 H85	S1 C2 R16 R19 M22 V23 R24 T25 P26 N28 L30 Q33 R35 K37 R38 S39 Q40 G41 H43 P45 W46 H50 R52 G54 G55 T56 K57 A58 R65 R69 H70 K72 S73 S75 R76 Y78 G79 G80 V81 H84

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links