Structure of PDB 8pv4 Chain Lh

Receptor sequence
>8pv4Lh (length=122) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
NGKVKAGQLWSKNKEELTKILGELKTELSQLRIQKISSSGAKLNKIHDLR
KSIARVLTVINAKQRAQLRLFYKNKKYLPLDLRPKLTRALRRRLSKEDAS
RVLEKTKKRLTHFPQRKYAVKA
3D structure
PDB8pv4 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
ChainLh
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.4.99.18: dolichyl-diphosphooligosaccharide--protein glycotransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lh K79 Y80 R86 R91 R95 K108 K111 R112 T114 H115 F116 K76 Y77 R83 R88 R92 K105 K108 R109 T111 H112 F113
BS02 rna Lh K8 W13 N47 K54 A57 R58 L60 T61 N64 R68 R72 L83 R86 K88 T90 R91 R94 K5 W10 N44 K51 A54 R55 L57 T58 N61 R65 R69 L80 R83 K85 T87 R88 R91
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0004576 oligosaccharyl transferase activity
GO:0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0016757 glycosyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0006486 protein glycosylation
GO:0018279 protein N-linked glycosylation via asparagine
GO:0043687 post-translational protein modification
Cellular Component
GO:0005840 ribosome
GO:0016020 membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pv4, PDBe:8pv4, PDBj:8pv4
PDBsum8pv4
PubMed37921038
UniProtG0S0D7

[Back to BioLiP]