Structure of PDB 8btr Chain Lh

Receptor sequence

>8btrLh (length=101) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

ADCRVTCRFHSTYRTRSKIVRYKRTPGNRLTSLRVKKLPNAPHCAETGKQ
IHGIPRVIPQHLTRQQRKVSRPYGGKLCGSALRAHILESFLNEENQALRE
I

3D structure

PDB

8btr Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.25 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lh	A2 D3 R5 V6 T7 R9 H11 S12 T13 Y14 R15 T16 R17 S18 R22 Y23 K24 R25 T26 P27 G28 N29 R30 L31 T32 L34 K37 K38 L39 P40 N41 P43 H44 H53 G54 I55 R57 P60 Q61 H62 T64 R65 Q66 R68 K69 S71 R72 P73 Y74 K77	A1 D2 R4 V5 T6 R8 H10 S11 T12 Y13 R14 T15 R16 S17 R21 Y22 K23 R24 T25 P26 G27 N28 R29 L30 T31 L33 K36 K37 L38 P39 N40 P42 H43 H52 G53 I54 R56 P59 Q60 H61 T63 R64 Q65 R67 K68 S70 R71 P72 Y73 K76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links