Structure of PDB 8brm Chain Lh

Receptor sequence

>8brmLh (length=96) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

DCRVTCRFHSTYRTRSKIVRYKRTPGNRLTSLRVKKLPNAPHCAETGKQI
HGIPRVIPQHLTRQQRKVSRPYGGKLCGSALRAHILESFLNEENQA

3D structure

PDB

8brm Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.33 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lh	D3 R5 V6 T7 R9 H11 S12 T13 Y14 R15 T16 R17 S18 K19 R22 Y23 R25 T26 P27 G28 N29 R30 T32 R35 K37 K38 L39 P40 N41 P43 H44 H53 G54 I55 R57 P60 Q61 H62 T64 R65 Q66 R68 K69 S71 R72 Y74 K77	D1 R3 V4 T5 R7 H9 S10 T11 Y12 R13 T14 R15 S16 K17 R20 Y21 R23 T24 P25 G26 N27 R28 T30 R33 K35 K36 L37 P38 N39 P41 H42 H51 G52 I53 R55 P58 Q59 H60 T62 R63 Q64 R66 K67 S69 R70 Y72 K75

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links