Structure of PDB 8rdw Chain Lg

Receptor sequence

>8rdwLg (length=137) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

MLQPKRTKFRKMHKGRNTGLAHRGSTVAFGQFGLKSLTRGRMTARQIEAA
RRTITRKIKRGGKIWIRVFPDKPISNKPLEVRMGKGKGPVEYWVCEIKPG
KMLYELEGISEELAREALTLAAAKLPFKTTIVKRTIM

3D structure

PDB

8rdw A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.74 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	P4 K5 R6 K8 F9 R10 K11 M12 H13 K14 G15 R16 N17 R23 G24 F29 R45 Q46 A49 R56 K63 W65 R67 F69 N76 K77 L79 E80 V81 R82 M83 G84 K85 G86 K87 A123 K124 L125 P126 K128	P4 K5 R6 K8 F9 R10 K11 M12 H13 K14 G15 R16 N17 R23 G24 F29 R45 Q46 A49 R56 K63 W65 R67 F69 N76 K77 L79 E80 V81 R82 M83 G84 K85 G86 K87 A123 K124 L125 P126 K128
BS02	rna	Lg	G19 H22 R39	G19 H22 R39

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links