Structure of PDB 8pv4 Chain Lg

Receptor sequence

>8pv4Lg (length=118) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

APTRVTYRRRNPYNTTSNRTRVIKTPGGQLRVLHIKKRGTAPKCGDCGIK
LPGIPALRPREYATISKPKKTVQRAYGGSRCGNCVRDRIIRAFLIEEQKI
VKKVLKEQSQAEKKASKK

3D structure

PDB

8pv4 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	R5 V6 T7 Y8 R9 R10 R11 N12 P13 Y14 N15 T16 T17 S18 R20 R22 K25 T26 P27 G28 R32 K37 K38 R39 T41 P43 K44 G46 K51 P53 G54 I55 A57 R59 P60 R61 T65 S67 K68 P69 K71 T72 V73 Q74 R75 Y77 G78 G79 R81 N84 R89 R92 A93 I96 E97 Q99 K100	R4 V5 T6 Y7 R8 R9 R10 N11 P12 Y13 N14 T15 T16 S17 R19 R21 K24 T25 P26 G27 R31 K36 K37 R38 T40 P42 K43 G45 K50 P52 G53 I54 A56 R58 P59 R60 T64 S66 K67 P68 K70 T71 V72 Q73 R74 Y76 G77 G78 R80 N83 R88 R91 A92 I95 E96 Q98 K99
BS02	ZN	Lg	C45 C48 C85	C44 C47 C84

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

External links