Structure of PDB 8oo0 Chain Lg

Receptor sequence

>8oo0Lg (length=112) Species: 209285 (Thermochaetoides thermophila)

PTRVTYRRRNPYNTTSNRTRVIKTPGGQLRVLHIKKRGTAPKCGDCGIKL
PGIPALRPREYATISKPKKTVQRAYGGSRCGNCVRDRIIRAFLIEEQKIV
KKVLKEQSQAEK

3D structure

• PDB: 8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
• Chain: Lg
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	P3 R5 V6 T7 Y8 R11 N12 P13 Y14 T16 K25 T26 P27 G28 R32 K37 K38 T41 P43 P53 G54 P60 R61 S67 R75 G79 R92 I96 E97 K103	P1 R3 V4 T5 Y6 R9 N10 P11 Y12 T14 K23 T24 P25 G26 R30 K35 K36 T39 P41 P51 G52 P58 R59 S65 R73 G77 R90 I94 E95 K101
BS02	ZN	Lg	C45 C48 C82 C85	C43 C46 C80 C83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
• PDBsum: 8oo0
• PubMed: 38267453
• UniProt: G0SFN0