Structure of PDB 8bsj Chain Lg

Receptor sequence
>8bsjLg (length=98) Species: 5741 (Giardia intestinalis) [Search protein sequence]
EEIKGKTFLPAIFVGYQRSRAKQRENVALVKVSGIYTRAETDKVLGRLIA
IIHSKSGKPIFGKICRPHGNSGMVRARFYTNLPGQLMGHKVRVFYDNI
3D structure
PDB8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
ChainLg
Resolution6.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lg K5 K7 T8 F9 Q18 R19 S20 R21 Q24 E26 R39 H54 R67 H69 N71 S72 M74 R76 N82 P84 G85 Q86 M88 K91 R93 K4 K6 T7 F8 Q17 R18 S19 R20 Q23 E25 R38 H53 R66 H68 N70 S71 M73 R75 N81 P83 G84 Q85 M87 K90 R92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bsj, PDBe:8bsj, PDBj:8bsj
PDBsum8bsj
PubMed36912103
UniProtA8BKK5

[Back to BioLiP]