Structure of PDB 7old Chain Lg

Receptor sequence

>7oldLg (length=112) Species: 759272 (Thermochaetoides thermophila DSM 1495)

PTRVTYRRRNPYNTTSNRTRVIKTPGGQLRVLHIKKRGTAPKCGDCGIKL
PGIPALRPREYATISKPKKTVQRAYGGSRCGNCVRDRIIRAFLIEEQKIV
KKVLKEQSQAEK

3D structure

• PDB: 7old High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.
• Chain: Lg
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	R5 T7 Y8 R9 R11 N12 P13 Y14 N15 T16 R22 I24 K25 T26 P27 G28 R32 K37 K38 R39 P43 P53 G54 I55 P60 R61 S67 K68 P69 K70 T72 R75 Y77 G79 N84 R89 R92 I96 K103	R3 T5 Y6 R7 R9 N10 P11 Y12 N13 T14 R20 I22 K23 T24 P25 G26 R30 K35 K36 R37 P41 P51 G52 I53 P58 R59 S65 K66 P67 K68 T70 R73 Y75 G77 N82 R87 R90 I94 K101
BS02	ZN	Lg	C45 C48 C82 C85	C43 C46 C80 C83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7old, PDBe:7old, PDBj:7old
• PDBsum: 7old
• PubMed: 35079002
• UniProt: G0SFN0