Structure of PDB 7olc Chain Lg

Receptor sequence

>7olcLg (length=112) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

PTRVTYRRRNPYNTTSNRTRVIKTPGGQLRVLHIKKRGTAPKCGDCGIKL
PGIPALRPREYATISKPKKTVQRAYGGSRCGNCVRDRIIRAFLIEEQKIV
KKVLKEQSQAEK

3D structure

PDB

7olc High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	P3 R5 V6 T7 Y8 R9 R10 R11 N12 P13 Y14 T16 R22 K25 T26 P27 R32 L34 K37 K38 R39 T41 P43 P53 G54 P56 P60 R61 S67 K68 K71 V73 Q74 R75 Y77 G79 N84 R89 R92 I96 E97 Q99 K103	P1 R3 V4 T5 Y6 R7 R8 R9 N10 P11 Y12 T14 R20 K23 T24 P25 R30 L32 K35 K36 R37 T39 P41 P51 G52 P54 P58 R59 S65 K66 K69 V71 Q72 R73 Y75 G77 N82 R87 R90 I94 E95 Q97 K101
BS02	ZN	Lg	C48 C82 C85	C46 C80 C83

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

External links