Structure of PDB 7nrc Chain Lg

Receptor sequence

>7nrcLg (length=127) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNIS
QPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNIS
AKNRVVILARAKALGIKVTNPKGRLAL

3D structure

PDB

7nrc Structure of Gcn1 bound to stalled and colliding 80S ribosomes.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	A2 K11 K12 K15 F17 R19 H21 D23 R24 Y25 H26 R27 V28 N31 W32 R33 K34 K36 G37 I38 D39 S40 R43 R44 R45 F46 R47 G48 I50 K54 I55 G56 Y57 G58 S59 N60 K61 K62 K64 F65 L66 S69 L75 K80 E95 A97 H98 N99 S101 K103 N104 R105 K118 N121 G124 R125	A1 K10 K11 K14 F16 R18 H20 D22 R23 Y24 H25 R26 V27 N30 W31 R32 K33 K35 G36 I37 D38 S39 R42 R43 R44 F45 R46 G47 I49 K53 I54 G55 Y56 G57 S58 N59 K60 K61 K63 F64 L65 S68 L74 K79 E94 A96 H97 N98 S100 K102 N103 R104 K117 N120 G123 R124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7nrc, PDBe:7nrc, PDBj:7nrc
PDBsum	7nrc
PubMed	33790014
UniProt	P38061\|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)