Structure of PDB 6zj3 Chain Lg

Receptor sequence

>6zj3Lg (length=181) Species: 3039 (Euglena gracilis)

PGFSGIRHYEIVGRAYPTEKEPSPKVYKMTVFAKNSVVGKARFWKLMRKQ
NKVKKTHGQVLQIRRIFEKNPNTIKNYSILLRYQSKTGVMNVSKEYRDTT
LCGAVHQMYMDMAGRHHARYLDIDIIGTTVLKPSQCLRPHIRQFLQHKVK
FPLLHRITKKLPQHKATFLYSKPSTYRSGFM

3D structure

• PDB: 6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
• Chain: Lg
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	F4 R8 Y10 S37 I64 R66 F68 E69 N71 P72 P134 L146 H148 K151	F3 R7 Y9 S36 I63 R65 F67 E68 N70 P71 P133 L145 H147 K150
BS02	rna	Lg	F4 K87 T88 M91 S94 K95 M111 A114 G115 R116 H117 H118 R120 R139 L162 P163	F3 K86 T87 M90 S93 K94 M110 A113 G114 R115 H116 H117 R119 R138 L161 P162
BS03	rna	Lg	L155 H156 I158 T159 K161 H165 A167 L170 Y171 S172 K173 P174 S175 T176 Y177 R178 S179 M182	L154 H155 I157 T158 K160 H164 A166 L169 Y170 S171 K172 P173 S174 T175 Y176 R177 S178 M181
BS04	rna	Lg	K46 K50 K53 K55 K56 K87 L122	K45 K49 K52 K54 K55 K86 L121

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 00:05:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zj3', asym_id = 'Lg', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zj3', asym_id='Lg', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'Lg'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='Lg')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>