Structure of PDB 6z6k Chain Lg

Receptor sequence

>6z6kLg (length=112) Species: 559292 (Saccharomyces cerevisiae S288C)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 6z6k Structure and function of yeast Lso2 and human CCDC124 bound to hibernating ribosomes.
• Chain: Lg
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	A2 R4 V5 T6 F7 R8 R9 R10 P12 Y13 N14 T15 S17 K24 T25 P26 G27 R31 Q33 K36 K37 T40 R41 P42 K43 Q52 G53 I54 S55 T56 P59 R60 A63 S66 K67 T68 K70 V72 S73 R74 Y76 G78 S79 R91 A92 I95 K99 K102	A1 R3 V4 T5 F6 R7 R8 R9 P11 Y12 N13 T14 S16 K23 T24 P25 G26 R30 Q32 K35 K36 T39 R40 P41 K42 Q51 G52 I53 S54 T55 P58 R59 A62 S65 K66 T67 K69 V71 S72 R73 Y75 G77 S78 R90 A91 I94 K98 K101
BS02	ZN	Lg	C44 C47 C84	C43 C46 C83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6z6k, PDBe:6z6k, PDBj:6z6k
• PDBsum: 6z6k
• PubMed: 32687489
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)