Structure of PDB 5lks Chain Lg

Receptor sequence

>5lksLg (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]

VQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPG
LRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKI
VVKVLKAQAQSQK

3D structure

PDB

5lks Structure-function insights reveal the human ribosome as a cancer target for antibiotics.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lg	R4 L5 T6 Y7 R8 R9 R10 S12 Y13 T15 R21 L22 R24 T25 P26 N28 R29 Y32 K37 P42 K43 V48 R54 R60 P61 K62 L64 M65 R66 S68 K69 T70 K72 H73 V74 S75 R76 Y78 G79 G80 R90 R93 A94 I97 E98 Q100 K115	R3 L4 T5 Y6 R7 R8 R9 S11 Y12 T14 R20 L21 R23 T24 P25 N27 R28 Y31 K36 P41 K42 V47 R52 R58 P59 K60 L62 M63 R64 S66 K67 T68 K70 H71 V72 S73 R74 Y76 G77 G78 R88 R91 A92 I95 E96 Q98 K113
BS02	ZN	Lg	S44 C49 C83	S43 C48 C81

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5lks, PDBe:5lks, PDBj:5lks
PDBsum	5lks
PubMed	27665925
UniProt	P49207\|RL34_HUMAN Large ribosomal subunit protein eL34 (Gene Name=RPL34)