Structure of PDB 8rxx Chain Lf

Receptor sequence

>8rxxLf (length=128) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

VKPTVSKAIVKKRTKRFTRHRYELFPQLSSSWRKPRGEDSPVRRRYKGQK
AMPNKGYGSDRATKYITPSGFRNFPINNVEDLYMLVMQNRKYAGVISHTV
GARKRKAIVRKAMELDVRLANGNAKLRK

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lf	K3 P4 V6 K12 K13 K16 R17 F18 R22 E24 F26 P27 Q28 L29 S32 W33 R34 K35 R37 E39 D40 S41 P42 R44 R45 R46 Y47 K48 G49 K51 P54 N55 K56 G57 Y58 G59 S60 D61 R62 K65 Y66 P69 S70 N78 N79 Y84 M88 V96 S98 H99 T100 G102 A103 R104 K105 R106 K107 R111 K112 R119 N122	K2 P3 V5 K11 K12 K15 R16 F17 R21 E23 F25 P26 Q27 L28 S31 W32 R33 K34 R36 E38 D39 S40 P41 R43 R44 R45 Y46 K47 G48 K50 P53 N54 K55 G56 Y57 G58 S59 D60 R61 K64 Y65 P68 S69 N77 N78 Y83 M87 V95 S97 H98 T99 G101 A102 R103 K104 R105 K106 R110 K111 R118 N121

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links