Structure of PDB 8pvk Chain Lf

Receptor sequence

>8pvkLf (length=108) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

PSEAGHRLYVKGRHLSYQRGRRNTHPKTSLIKIEGVDDTAAANFYLGKRV
AYVYRAQKEVRGTKIRVIWGKITRPHGNSGVVRAKFTHPLPARSFGASVR
IMLYPSSI

3D structure

PDB

8pvk Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lf	P2 S3 E4 A5 H7 R8 L9 Y10 K12 Q19 R20 G21 R22 R23 T25 H26 P27 K28 L47 G48 R50 Y55 R56 Q58 K59 V61 R62 T64 K65 I66 V68 W70 K72 T74 R75 H77 G78 N79 S80 R84 K86 H89 P90 P92 A93 R94 F96 A98 S99 R101	P1 S2 E3 A4 H6 R7 L8 Y9 K11 Q18 R19 G20 R21 R22 T24 H25 P26 K27 L46 G47 R49 Y54 R55 Q57 K58 V60 R61 T63 K64 I65 V67 W69 K71 T73 R74 H76 G77 N78 S79 R83 K85 H88 P89 P91 A92 R93 F95 A97 S98 R100

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links