Structure of PDB 8k82 Chain Lf

Receptor sequence

>8k82Lf (length=106) Species: 4932 (Saccharomyces cerevisiae)

AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
VYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
LYPSNI

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Lf
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lf	A2 E3 S4 H5 R6 Y8 K10 Q17 R18 S19 K20 R21 V22 N23 P25 Q42 G46 R48 Y53 R54 S56 K57 R60 S62 I64 R65 V66 W68 R73 H75 G76 N77 S78 R82 R86 N87 N88 P90 A91 K92 F94 S97 R99 N106	A1 E2 S3 H4 R5 Y7 K9 Q16 R17 S18 K19 R20 V21 N22 P24 Q41 G45 R47 Y52 R53 S55 K56 R59 S61 I63 R64 V65 W67 R72 H74 G75 N76 S77 R81 R85 N86 N87 P89 A90 K91 F93 S96 R98 N105

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P05744|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)