Structure of PDB 8bsi Chain Lf

Receptor sequence

>8bsiLf (length=125) Species: 5741 (Giardia intestinalis) [Search protein sequence]

HPLPHKIIIKKRKNKFIRFQSERFVRVKPSWRKPRGIDSPMRHQYRGQRP
MVSIGYGSDKETRFMLPCGFFKHRISTVHELKTLFMNNKTHAAQIAHGVS
ARSRKQILEEAKKMGVRVLNADAKL

3D structure

PDB

8bsi Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lf	K16 K17 R18 K21 F22 R24 F25 Q26 E28 F30 V31 R32 V33 K34 S36 W37 R38 K39 R41 G42 I43 D44 R48 H49 Q50 Y51 R52 G53 R55 V58 S59 I60 G61 Y62 G63 S64 D65 K66 R69 F70 P73 K78 R80 S82 H85 Q100 A102 H103 G104 V105 S106 A107 R108 S109 R110 N126 K130	K10 K11 R12 K15 F16 R18 F19 Q20 E22 F24 V25 R26 V27 K28 S30 W31 R32 K33 R35 G36 I37 D38 R42 H43 Q44 Y45 R46 G47 R49 V52 S53 I54 G55 Y56 G57 S58 D59 K60 R63 F64 P67 K72 R74 S76 H79 Q94 A96 H97 G98 V99 S100 A101 R102 S103 R104 N120 K124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links