Structure of PDB 7zjw Chain Lf

Receptor sequence
>7zjwLf (length=108) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
VAAKKTKKSLESINSRLQLVMKSGKYVLGYKQSLKMIRQGKAKLVILANN
CPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLSIIDPGD
SDIIRSMP
3D structure
PDB7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
ChainLf
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lf L29 G30 Y31 K32 Q33 K36 P53 A54 R56 Y89 R90 V91 C92 L28 G29 Y30 K31 Q32 K35 P52 A53 R55 Y88 R89 V90 C91
BS02 rna Lf K5 K8 K4 K7
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0031640 killing of cells of another organism
GO:0050829 defense response to Gram-negative bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
PDBsum7zjw
PubMed35709277
UniProtG1TDL2|RL30_RABIT Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]