Structure of PDB 7cpv Chain Lf

Receptor sequence

>7cpvLf (length=109) Species: 10090 (Mus musculus)

SGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVY
KAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRI
RVMLYPSRI

3D structure

• PDB: 7cpv A male germ-cell-specific ribosome controls male fertility.
• Chain: Lf
• Resolution: 3.03 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lf	S2 G3 R4 L5 W6 K8 K15 R16 G17 L18 R19 N20 Q21 E23 H24 K29 Y34 R36 L43 R46 Y51 K52 K54 N55 N56 T57 V58 T59 P60 R68 V69 W71 K73 T75 R76 H78 G79 N80 S81 R85 K87 R89 S90 N91 P93 A94 K95 H99 R100 R102 Y106 R109	S1 G2 R3 L4 W5 K7 K14 R15 G16 L17 R18 N19 Q20 E22 H23 K28 Y33 R35 L42 R45 Y50 K51 K53 N54 N55 T56 V57 T58 P59 R67 V68 W70 K72 T74 R75 H77 G78 N79 S80 R84 K86 R88 S89 N90 P92 A93 K94 H98 R99 R101 Y105 R108
BS02	MG	Lf	T57 T67	T56 T66

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0140236 translation at presynapse
• GO:0140242 translation at postsynapse

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0045202 synapse
• GO:0098793 presynapse
• GO:0098794 postsynapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7cpv, PDBe:7cpv, PDBj:7cpv
• PDBsum: 7cpv
• PubMed: 36517592
• UniProt: O55142|RL35A_MOUSE Large ribosomal subunit protein eL33 (Gene Name=Rpl35a)