Structure of PDB 8pv7 Chain Le

Receptor sequence

>8pv7Le (length=126) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

VAAKKHVPIVKKRTKRFMRHQSDRFKCLDSAWRKPKGIDNRVRRRFKGNL
AMPSIGYGSNKKTKHMMPSGHKAFLVHNVKDVELLLMHNRTYAAEIAHNV
SSRKRIDIITRAKQLGVKVTNAKAKV

3D structure

PDB

8pv7 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.12 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Le	V8 K12 K13 K16 R17 F18 R20 H21 Q22 D24 K27 C28 L29 W33 R34 K35 K37 I39 N41 R44 R45 R46 F47 K48 G49 P54 S55 I56 G57 Y58 G59 S60 N61 K62 K63 K65 H66 M67 P69 S70 N79 K81 E96 A98 H99 N100 S102 R104 K105 R106 K119 N122 A125 K126	V7 K11 K12 K15 R16 F17 R19 H20 Q21 D23 K26 C27 L28 W32 R33 K34 K36 I38 N40 R43 R44 R45 F46 K47 G48 P53 S54 I55 G56 Y57 G58 S59 N60 K61 K62 K64 H65 M66 P68 S69 N78 K80 E95 A97 H98 N99 S101 R103 K104 R105 K118 N121 A124 K125

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links