Structure of PDB 8pvl Chain Ld

Receptor sequence

>8pvlLd (length=110) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

AIADVVAREYTIHLHKRLHGVTFKKRAPRAIKEIKKFAQKAMGTSDVRLD
PQLNKKVWEQGIKGVPFRIRVRISRRRNDEEGAKEKLYSYVQAVNVKNPK
GLLTSVVEEE

3D structure

PDB

8pvl Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.19 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ld	I12 R18 T21 H23 H25 K26 R27 H29 G30 V31 T32 F33 K34 R36 R39 I41 K42 F47 L59 P61 N64 K65 W68 Q70 I72 K73 F77 R78 K110 G111 L112 L113	I2 R8 T11 H13 H15 K16 R17 H19 G20 V21 T22 F23 K24 R26 R29 I31 K32 F37 L49 P51 N54 K55 W58 Q60 I62 K63 F67 R68 K100 G101 L102 L103

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links