Structure of PDB 8i9x Chain Ld

Receptor sequence

>8i9xLd (length=109) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

IADVVAREYTIHLHKRLHGVTFKKRAPRAIKEIKKFAQKAMGTSDVRLDP
QLNKKVWEQGIKGVPFRIRVRISRRRNDEEGAKEKLYSYVQAVNVKNPKG
LLTSVVEEE

3D structure

PDB

8i9x Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ld	R18 T21 H23 H25 K26 R27 H29 G30 V31 T32 F33 K34 K35 K42 K45 F47 K50 L59 P61 N64 K65 W68 Q70 I72 K73 F77 R78 K110 G111 L112 L113 T114	R7 T10 H12 H14 K15 R16 H18 G19 V20 T21 F22 K23 K24 K31 K34 F36 K39 L48 P50 N53 K54 W57 Q59 I61 K62 F66 R67 K99 G100 L101 L102 T103

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links