Structure of PDB 8glp Chain Lc

Receptor sequence
>8glpLc (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKS
EIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRS
3D structure
PDB8glp mRNA decoding in human is kinetically and structurally distinct from bacteria.
ChainLc
Resolution1.67 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Lc L29 G30 Y31 K32 Q33 P53 A54 R56 K57 S58 Y89 R90 V91 C92 L21 G22 Y23 K24 Q25 P45 A46 R48 K49 S50 Y81 R82 V83 C84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0031640 killing of cells of another organism
GO:0050829 defense response to Gram-negative bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8glp, PDBe:8glp, PDBj:8glp
PDBsum8glp
PubMed37020024
UniProtP62888|RL30_HUMAN Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]