Structure of PDB 8btd Chain Lc

Receptor sequence
>8btdLc (length=55) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]
AKLKNHTSKNQNRKDHRNGIKKPKKSAYTSHKGMCPKYLRNLRRSRANDP
RQSLR
3D structure
PDB8btd Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
ChainLc
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lc K3 K5 N6 H7 T8 S9 K10 N11 Q12 N13 R14 K15 H17 R18 K23 P37 K38 Y39 R41 N42 L43 R45 S46 R47 N49 P51 R52 S54 R56 K2 K4 N5 H6 T7 S8 K9 N10 Q11 N12 R13 K14 H16 R17 K22 P36 K37 Y38 R40 N41 L42 R44 S45 R46 N48 P50 R51 S53 R55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8btd, PDBe:8btd, PDBj:8btd
PDBsum8btd
PubMed36912103
UniProtA8BYY2

[Back to BioLiP]