Structure of PDB 6zj3 Chain Lc

Receptor sequence

>6zj3Lc (length=203) Species: 3039 (Euglena gracilis) [Search protein sequence]

GRRPAKCYRYCKNKAYPKSRYCRGVPEAKIRIYDCGMRKLNADTFPLTYH
LISMEREQIGSEALEAARINANKYMIKNAGKEAYHIRVRVHPFHVCRINK
MLGMRGAFGKPNGLAARVRIGQPLMSIRVKPQHEAVVVAALKRASYKFAG
RQVIAKSTMWGFTEIRSENYVKWKEEGKFRVDGVSTKILRNRGRLHRAKR
VRA

3D structure

PDB

6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.

Chain

Resolution

3.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Lc	A16 Y22 Y34 D35 R39 K40 R90 H92 F94 Q133 E175 D193 G194 S196 K198 R208 K210 R213	A15 Y21 Y33 D34 R38 K39 R89 H91 F93 Q122 E164 D182 G183 S185 K187 R197 K199 R202
BS02	rna	Lc	R4 C8 K13 N14 K15 R98 G114 A118 F119 G120 Y157	R3 C7 K12 N13 K14 R97 G103 A107 F108 G109 Y146
BS03	rna	Lc	R4 A6 C8 K15 R24 E63 A64 K74 L103 G114 M115 R116 F119 R154 Y157 K158	R3 A5 C7 K14 R23 E62 A63 K73 L102 G103 M104 R105 F108 R143 Y146 K147
BS04	rna	Lc	Y11 E56 R57 R201 N202 R203 G204 R205 L206	Y10 E55 R56 R190 N191 R192 G193 R194 L195

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zj3, PDBe:6zj3, PDBj:6zj3
PDBsum	6zj3
PubMed	33091122
UniProt	Q39724\|RL10_EUGGR Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]