Structure of PDB 8xsy Chain Lb

Receptor sequence

>8xsyLb (length=109) Species: 9606 (Homo sapiens)

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMSARAEAIKALVVSRKLDRLAYIAHPKLGKRARARIA
KGLRLCRPK

3D structure

• PDB: 8xsy Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Lb
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lb	A2 K3 S4 K5 N6 H7 T8 T9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 R25 S26 Q27 R28 Y29 S31 L32 K33 D36 P37 K38 F39 R41 N42 M43 R44 F45 A46 K47 K48 H49 N50 K51 K55 K56 M57 M65 S90 R91 K92 D94 R95 Y98 H101 P102 K103 R107 R111 K114 G115 R117 L118 C119 R120 K122	A1 K2 S3 K4 N5 H6 T7 T8 H9 N10 Q11 S12 R13 K14 H16 R17 N18 R24 S25 Q26 R27 Y28 S30 L31 K32 D35 P36 K37 F38 R40 N41 M42 R43 F44 A45 K46 K47 H48 N49 K50 K54 K55 M56 M64 S77 R78 K79 D81 R82 Y85 H88 P89 K90 R94 R98 K101 G102 R104 L105 C106 R107 K109

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008201 heparin binding
• GO:0045296 cadherin binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0007566 embryo implantation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xsy, PDBe:8xsy, PDBj:8xsy
• PDBsum: 8xsy
• PubMed: 38942792
• UniProt: P47914|RL29_HUMAN Large ribosomal subunit protein eL29 (Gene Name=RPL29)