Structure of PDB 8rxh Chain Lb

Receptor sequence

>8rxhLb (length=68) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

AKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNARRVRKHN
QKAALKKRRERIAAFAAK

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lb	K5 N6 H7 T8 N9 H10 N11 Q12 S13 K15 H17 R18 N19 P26 H28 L29 H30 N31 S32 K33 R34 L38 N43 R45 R46 V47 R48 K49 H50 N51 Q52 R60 R62	K4 N5 H6 T7 N8 H9 N10 Q11 S12 K14 H16 R17 N18 P25 H27 L28 H29 N30 S31 K32 R33 L37 N42 R44 R45 V46 R47 K48 H49 N50 Q51 R59 R61
BS02	rna	Lb	K3 N6 H7 R34 G35 W37 L38	K2 N5 H6 R33 G34 W36 L37

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links