Structure of PDB 6zm7 Chain Lb

Receptor sequence

>6zm7Lb (length=109) Species: 9606 (Homo sapiens) [Search protein sequence]

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMSARAEAIKALVVSRKLDRLAYIAHPKLGKRARARIA
KGLRLCRPK

3D structure

PDB

6zm7 Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lb	A2 K3 K5 N6 H7 T8 T9 H10 N11 Q12 R14 K15 H17 R18 N19 K23 S26 Q27 R28 Y29 S31 L32 K33 D36 P37 K38 R41 N42 M43 R44 F45 A46 K47 K48 H49 K51 K52 K56 M57 N60 N61 M65 R68 S90 R91 K92 R95 Y98 H101 P102 K103 R107 R111 G115 R117 L118 R120	A1 K2 K4 N5 H6 T7 T8 H9 N10 Q11 R13 K14 H16 R17 N18 K22 S25 Q26 R27 Y28 S30 L31 K32 D35 P36 K37 R40 N41 M42 R43 F44 A45 K46 K47 H48 K50 K51 K55 M56 N59 N60 M64 R67 S77 R78 K79 R82 Y85 H88 P89 K90 R94 R98 G102 R104 L105 R107

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008201	heparin binding
GO:0045296	cadherin binding

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6zm7, PDBe:6zm7, PDBj:6zm7
PDBsum	6zm7
PubMed	32680882
UniProt	P47914\|RL29_HUMAN Large ribosomal subunit protein eL29 (Gene Name=RPL29)