Structure of PDB 6t7t Chain Lb

Receptor sequence

>6t7tLb (length=58) Species: 559292 (Saccharomyces cerevisiae S288C)

AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTA
KALAAAKK

3D structure

• PDB: 6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
• Chain: Lb
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lb	A2 K3 S4 K5 N6 H7 T8 A9 H10 N11 Q12 T13 R14 K15 H17 R18 N19 T26 Y27 K28 Y29 L32 K33 D36 P37 K38 F39 R41 N42 H43 H45 A46 L47 G49 T50	A1 K2 S3 K4 N5 H6 T7 A8 H9 N10 Q11 T12 R13 K14 H16 R17 N18 T25 Y26 K27 Y28 L31 K32 D35 P36 K37 F38 R40 N41 H42 H44 A45 L46 G48 T49

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
• PDBsum: 6t7t
• PubMed: 31858614
• UniProt: P05747|RL29_YEAST Large ribosomal subunit protein eL29 (Gene Name=RPL29)