Structure of PDB 8y0u Chain La

Receptor sequence

>8y0uLa (length=148) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPG
YFGKVGMRYFHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPV
IDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA

3D structure

PDB

8y0u dormant ribosome with STM1

Chain

Resolution

3.59 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	La	P2 S3 R4 K7 T8 R9 K10 H11 R12 G13 H14 V15 G18 G20 R21 I22 G23 K24 H25 R26 K27 H28 P29 G30 R32 G33 M34 A35 G36 H40 H41 R42 I43 N44 K47 Y52 G54 K55 V56 M58 R59 Y60 F61 H62 K63 Q64 H67 N74 L113 G114 K115 R117 S131 L133	P1 S2 R3 K6 T7 R8 K9 H10 R11 G12 H13 V14 G17 G19 R20 I21 G22 K23 H24 R25 K26 H27 P28 G29 R31 G32 M33 A34 G35 H39 H40 R41 I42 N43 K46 Y51 G53 K54 V55 M57 R58 Y59 F60 H61 K62 Q63 H66 N73 L112 G113 K114 R116 S130 L132

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum	8y0u
PubMed	38698775
UniProt	P02406\|RL28_YEAST Large ribosomal subunit protein uL15 (Gene Name=RPL28)

[Back to BioLiP]