Structure of PDB 8rxx Chain La

Receptor sequence

>8rxxLa (length=125) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

SHHMKIKDLREKSKDDLLKTLTEYKKELSQLRVVQQTGGAETRLGRIRPI
RKSIARILTVLNQNERSNLKMFYADRKLRCKTPKVLRTKLTHRRRLALKE
NEKNRKTSRQMRQAHKFPKRVYAVK

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	La	R77 K78 R80 K82 H93 R94 L97 N102 N105 R106 K107 S109 M112 R113 H116 K117 K120 R121	R76 K77 R79 K81 H92 R93 L96 N101 N104 R105 K106 S108 M111 R112 H115 K116 K119 R120
BS02	rna	La	S2 H4 K6 I7 K8 R11 Q36 E42 L45 R47 R49 R52 K53 A56 R57 L59 T60 N63 Q64 R67 K85 R88 K90 T92 H93 R94 R96	S1 H3 K5 I6 K7 R10 Q35 E41 L44 R46 R48 R51 K52 A55 R56 L58 T59 N62 Q63 R66 K84 R87 K89 T91 H92 R93 R95

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links