Structure of PDB 8pvk Chain La

Receptor sequence

>8pvkLa (length=108) Species: 759272 (Thermochaetoides thermophila DSM 1495)

PTRFSKTRKHRGHVVGMRHFHLLRNHYWRPSINIDKLWSLVPSDVREQYL
SGQKKDTAPVIDLLSHGYAKLLGKGRLPEIPVVVRARYVSAEAERKVKEA
GGVVELVA

3D structure

• PDB: 8pvk Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: La
• Resolution: 2.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	La	P2 T3 R4 F5 S6 K7 T8 R9 K10 R12 G13 V15 G57 M58 R59 H60 F61 H62 L63 R65 N66 H67 R70 N74 K77 K111 L113 G114 K115 G116 R117 S131	P1 T2 R3 F4 S5 K6 T7 R8 K9 R11 G12 V14 G16 M17 R18 H19 F20 H21 L22 R24 N25 H26 R29 N33 K36 K70 L72 G73 K74 G75 R76 S90

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Apr 27 22:55:48 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8pvk', asym_id = 'La', title = 'Structural insights into coordinating 5S RNP rot...TS2 pre-RNA processing during ribosome formation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8pvk', asym_id='La', title='Structural insights into coordinating 5S RNP rot...TS2 pre-RNA processing during ribosome formation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '8pvk', asym_id = 'La'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='8pvk', asym_id='La')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>