Structure of PDB 6y57 Chain La

Receptor sequence

>6y57La (length=146) Species: 9606 (Homo sapiens) [Search protein sequence]

PSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPG
YFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTAAPIID
VVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACVLVA

3D structure

PDB

6y57 Dynamics of uS19 C-Terminal Tail during the Translation Elongation Cycle in Human Ribosomes.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	La	P2 S3 R4 R6 K7 T8 R9 K10 R12 H14 V15 H17 G18 H19 G20 R21 I22 G23 H25 R26 K27 H28 P29 G30 G31 R32 G33 N34 G36 H39 H40 H41 R42 I43 N44 K47 Y52 F53 G54 K55 V56 G57 M58 K59 H60 Y61 H62 K64 R65 N66 N74 K77 L81 V82 S83 Q85 N89 D102 R105 K110 L112 G113 K114 G115 K116 S130 R131 R132 K136	P1 S2 R3 R5 K6 T7 R8 K9 R11 H13 V14 H16 G17 H18 G19 R20 I21 G22 H24 R25 K26 H27 P28 G29 G30 R31 G32 N33 G35 H38 H39 H40 R41 I42 N43 K46 Y51 F52 G53 K54 V55 G56 M57 K58 H59 Y60 H61 K63 R64 N65 N73 K76 L80 V81 S82 Q84 N88 D100 R103 K108 L110 G111 K112 G113 K114 S128 R129 R130 K134

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6y57, PDBe:6y57, PDBj:6y57
PDBsum	6y57
PubMed	32268098
UniProt	P46776\|RL27A_HUMAN Large ribosomal subunit protein uL15 (Gene Name=RPL27A)