Structure of PDB 8bsj Chain LZ

Receptor sequence

>8bsjLZ (length=133) Species: 5741 (Giardia intestinalis) [Search protein sequence]

MKLNSAVTASRRKCRKAYFTANAETRAKMMSSRLSKELRAEHKIKTMPIR
RGDIVEIFTGGHKGTGKVVEVRRRDYKICVEGINQKARNPEAKPVPYPIH
PSNCIIKELYMNGSRYRAIKRRQERNAERLARI

3D structure

PDB

8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

6.49 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LZ	R11 R12 R15 K16 F19 N22 A23 E24 R50 R51 V71 R73 R74 N112 G113 S114 Y116 R117	R11 R12 R15 K16 F19 N22 A23 E24 R50 R51 V71 R73 R74 N112 G113 S114 Y116 R117
BS02	rna	LZ	M1 K2 N4 A6 T8 A9 R11 Y18 K28 M29 S31 R33 K45 T46 G60 G61 Q85 K86 R88 N89 Y97 P98 H100 S102 R122 R125 N126 R129 I133	M1 K2 N4 A6 T8 A9 R11 Y18 K28 M29 S31 R33 K45 T46 G60 G61 Q85 K86 R88 N89 Y97 P98 H100 S102 R122 R125 N126 R129 I133

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

External links