Structure of PDB 7mq9 Chain LZ

Receptor sequence
>7mq9LZ (length=183) Species: 9606 (Homo sapiens) [Search protein sequence]
VRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQL
SRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFV
TASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVT
RSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
3D structure
PDB7mq9 Nucleolar maturation of the human small subunit processome.
ChainLZ
Resolution3.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LZ K4 H29 R35 R36 Y37 N49 Q50 R53 R56 R60 F100 T102 A103 S104 R108 K117 R119 H123 Q125 R152 K3 H28 R34 R35 Y36 N48 Q49 R52 R55 R59 F99 T101 A102 S103 R107 K116 R118 H122 Q124 R151
BS02 rna LZ F7 K11 L12 L13 K14 Q133 K165 H169 F6 K10 L11 L12 K13 Q132 K164 H168
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030515 snoRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030684 preribosome
GO:0032040 small-subunit processome
GO:0034457 Mpp10 complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mq9, PDBe:7mq9, PDBj:7mq9
PDBsum7mq9
PubMed34516797
UniProtQ9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 (Gene Name=IMP3)

[Back to BioLiP]