Structure of PDB 5wlc Chain LZ

Receptor sequence

>5wlcLZ (length=182) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

VRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRIC
GDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKV
TVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVT
RNMEDYVTWVDNSKIKKTLLRYRNQIDDFDFS

3D structure

PDB

5wlc The complete structure of the small-subunit processome.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LZ	V2 R3 Q25 R28 M33 R34 Y36 H37 Y44 N48 R49 R55 R56 N59 T89 V103 S104 R108 H116 R117 T123 Q125	V1 R2 Q24 R27 M32 R33 Y35 H36 Y43 N47 R48 R54 R55 N58 T88 V102 S103 R107 H115 R116 T122 Q124
BS02	rna	LZ	H7 K11 L12 K14 K15 K129 Q133 H135 K165 I166	H6 K10 L11 K13 K14 K128 Q132 H134 K164 I165

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0030515	snoRNA binding

	Biological Process
GO:0006364	rRNA processing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030686	90S preribosome
GO:0032040	small-subunit processome
GO:0034457	Mpp10 complex
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5wlc, PDBe:5wlc, PDBj:5wlc
PDBsum	5wlc
PubMed	28945246
UniProt	P32899\|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 (Gene Name=IMP3)

[Back to BioLiP]