Structure of PDB 8y0u Chain LY

Receptor sequence

>8y0uLY (length=125) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKL

3D structure

PDB

8y0u dormant ribosome with STM1

Chain

Resolution

3.59 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LY	A2 K3 Q4 S9 S10 R12 R16 Y19 S32 K37 R60 S62 K87 K89 V90 N91 H100 S102 K103 K122	A1 K2 Q3 S8 S9 R11 R15 Y18 S31 K36 R59 S61 K86 K88 V89 N90 H99 S101 K102 K121
BS02	rna	LY	R13 R16 F20 S24 R51 R52 V73 Y74 R75 D112 K113 D114 K116	R12 R15 F19 S23 R50 R51 V72 Y73 R74 D111 K112 D113 K115

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0032991	protein-containing complex
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum	8y0u
PubMed	38698775
UniProt	P05743\|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)