Structure of PDB 8pv8 Chain LY

Receptor sequence

>8pv8LY (length=133) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

MKVRPTVSSSRRKARKAHFSAPSSVRRVIMSAPLSKELREKYNVRSIPIR
KGDEVQIVRGAHKDKEGKVTSVYRLKYVIHVERVTREKATGQTVPIGIHP
SNVVITKLHLDKDRENILARIKAGREQVAKAKG

3D structure

PDB

8pv8 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.91 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LY	M1 K2 V3 R4 P5 V7 S8 S9 R11 A14 R15 H18 V28 S31 P33 R45 S46 V58 R59 G60 A61 K63 K76 R86 K88 A89 T90 H99 S101 N102 R120 G124 R125 Q127 V128 K132	M1 K2 V3 R4 P5 V7 S8 S9 R11 A14 R15 H18 V28 S31 P33 R45 S46 V58 R59 G60 A61 K63 K76 R86 K88 A89 T90 H99 S101 N102 R120 G124 R125 Q127 V128 K132
BS02	rna	LY	R11 R12 R15 K16 F19 P22 S24 R27 R50 K51 V72 Y73 R74 D113 I117 R120	R11 R12 R15 K16 F19 P22 S24 R27 R50 K51 V72 Y73 R74 D113 I117 R120

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

External links