Structure of PDB 7olc Chain LY

Receptor sequence

>7olcLY (length=134) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

MKVRPTVSSSRRKARKAHFSAPSSVRRVIMSAPLSKELREKYNVRSIPIR
KGDEVQIVRGAHKDKEGKVTSVYRLKYVIHVERVTREKATGQTVPIGIHP
SNVVITKLHLDKDRENILARIKAGREQVAKAKGK

3D structure

PDB

7olc High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LY	M1 V3 R4 S8 S9 R11 K13 H18 P33 R45 S46 R59 G60 A61 R86 A89 H99 S101 R120 G124 R125 V128	M1 V3 R4 S8 S9 R11 K13 H18 P33 R45 S46 R59 G60 A61 R86 A89 H99 S101 R120 G124 R125 V128
BS02	rna	LY	R12 R15 K16 F19 S24 R27 R50 Y73 R74 D113	R12 R15 K16 F19 S24 R27 R50 Y73 R74 D113

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

External links